PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 212aa    MW: 24080.9 Da    PI: 7.4719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014557genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-162067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a   g++Rt+k+c++rw++yl
      Lus10014557 20 KGPWTMEEDLILINYIANHGEGVWNSLALSAGLKRTGKSCRLRWLNYL 67
                     79********************************************97 PP

2Myb_DNA-binding521.7e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE+ l+ d++ ++G++ W++Ia++++ gRt++++k++w++
      Lus10014557  73 RGNITLEEQILIMDLHSKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1171567IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-211870IPR009057Homeodomain-like
SuperFamilySSF466891.91E-2919114IPR009057Homeodomain-like
SMARTSM007176.8E-121969IPR001005SANT/Myb domain
PfamPF002491.1E-152067IPR001005SANT/Myb domain
CDDcd001672.12E-92267No hitNo description
PROSITE profilePS5129423.91668122IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-2471123IPR009057Homeodomain-like
SMARTSM007177.2E-1472120IPR001005SANT/Myb domain
PfamPF002499.2E-1573116IPR001005SANT/Myb domain
CDDcd001676.88E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MEYRTEQPPK EAGGEGIIRK GPWTMEEDLI LINYIANHGE GVWNSLALSA GLKRTGKSCR  60
LRWLNYLRPD VRRGNITLEE QILIMDLHSK WGNRWSKIAK HLPGRTDNEI KNYWRTRIQK  120
HLKQSGLQSS SPPGSGSDHH HQLDTSTHTS QLVSGYNHYY HGVDHHPMEA TMVGECSGSG  180
SNTMQSDQPS FEGRHWSMEE LWSMELFNSG S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23201227108B-MYB
1h8a_C1e-231812225128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6178261e-110AB617826.1 Linum grandiflorum MYB21 mRNA for transcription factor MYB21, complete cds, cultivar: Red Flax.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097428.18e-80PREDICTED: myb-related protein 305
SwissprotP813914e-78MYB05_ANTMA; Myb-related protein 305
TrEMBLG9M8Q21e-106G9M8Q2_9R
STRINGGLYMA16G07960.17e-76(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.14e-71myb domain protein 24